Doodle

1,970 Coloring Pages of Pollinator

plantsflowersornamentalpollinator-friendlyperennialgardenanimalswildflowerfragranttropical
Bell Flower from Bellflower
Cosmos Bipinnatus from Cosmos
Purple Coneflower from Coneflowers
Hummingbird from Cartoon animals viii coloring book
Calliope Hummingbird from Hummingbirds
Beehive from Simple objects iv coloring book
Nettle-leaved Bellflower from Bellflower
Ruby-throated Hummingbird from Hummingbirds
Meadow Buttercup, Ranunculus Acris from Buttercup
Lupine from Lupin
Ivy-leaf Morning Glory from Morning glory
Showy Evening Primrose from Primrose
Ophrys Speculum or the Mirror of Venus Orchid from Orchid
Maxillaria Nigrescens Orchid from Orchid
Heliconia flower from Heliconia
Solidago or Goldenrod from Goldenrod
Snapdragon Vine from Snapdragon
Gladiolus 2 from Gladiolus
Moths Insect from Animals
Vanda Coerulea or Blue Vanda Orchid from Orchid
Clarkia Amoena Farewell to Spring from Godetia
Marigold from Marigolds
Europeana Floribunda Rose from Roses
Insect from Nps
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Marigold from Marigolds
Wild Rose from Roses
Sophronitis Cernua Orchid from Orchid
Slipper Orchids Paphiopedilum from Orchid
Praying Mantis and Butterfly Among Flowers from Insects
Grasshopper in Garden from Grasshoppers
Iris Flower Blossom from Iris
California Fire Chalice from Celebrating wildflowers coloring book
Bird of Paradise Plant from Bird of paradise
Hummingbird from Simple animals coloring book
Bee from Simple animals coloring book
Blooming Hibiscus Flower from Hawaii flower
Larkspur from Larkspur
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Ladybug from Simple animals coloring book
Saucer Magnolia from Magnolia
Daffodil from Daffodil
Youth-and-Age Zinnia Flowers from Zinnia
Ladybug from Ladybug
Orange Honeysuckle from Celebrating wildflowers coloring book
Ragged Robin or Deerhorn Clarkia from Celebrating wildflowers coloring book
American Twinflower from Celebrating wildflowers coloring book
Bird of Paradise Flower from Bird of paradise
Horse Chestnut from Chestnut
Bee from Cartoon animals vi coloring book
Ladybug from Ladybug
Dog Rose Flowers from Wildflower
Bee from Cartoon animals vi coloring book
Western Blue Flax from Celebrating wildflowers coloring book
Lavender from Lavender
Butterflies and Flowers on a Meadow from Summer
Ladybug from Ladybug
Daisy from Plants ii coloring book
Rice Paper Butterfly from Animals
Butterfly on Daisy from Flower and butterfly
Pleurothallis Schiedei Orchid from Orchid
American Redstart Birds and Honeycomb from Animals
Frigid Leafcutter Bee (Megachile Frigida) from Nps
Daisy from Daisy
Parade Bush Rose with Butterfly from Roses
Charisma Yellow Red Floribunda Rose from Roses
Rabbit Smelling Tulip from Grass
Flower Parts from Botanical
Black Orchid from Orchid
'I'iwi Bird - Hawaiʻi Volcanoes NP from Nps
Tiger Lily, Spring Flowers, a Butterfly and a Banana Slug in Redwood NP from Nps
Ruby Throated Hummingbird from Hummingbirds
Erythronium Americanum or Trout Lily from Wildflower
Viola Adunca or Pale Mountain Violet from Violet
Hemerocallis Spp or Day Lily from Perennial
Marigold from Marigolds
Daisy from Daisy
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Flower Poppy from Red
Daffodil Flowers from Daffodil
Orchid Lycaste Aromatica from Orchid
Evening Primrose from Primrose
Iris Pseudacorus or Yellow Flag Iris from Iris
Hummingbird from Hummingbirds
Violet Flower from Violet
Hummingbird Spread-wing from Hummingbirds
Antirrhinum Majus or Common Snapdragon from Snapdragon
Bee on Rosa Mundi Rose from Roses
Iris Motif from Iris
Costa's hummingbird range map from Hummingbirds
Black Elderberry from Elderberry
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Gerbera Daisies from Gerberas
Rocky Mountain Columbine from Columbine
Swallow Tail Hummingbird from Hummingbirds
Dandelion from Plants iii coloring book
European Michaelmas-daisy from Asters
Summer Flowers from Summer
Apple Blossom Branch from Apple tree
Aster or Star Plant from Asters
201 - 300 of 1,970 Next page
/ 20